United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

sPLA2-IIA Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Phospholipase A2 membrane associated, GIIC sPLA2, Group IIA phospholipase A2, Non-pancreatic secretory phospholipase A2, NPS-PLA2, Phosphatidylcholine 2-acylhydrolase 2A, PLA2G2A, PLA2B, PLA2L, RASF-A
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD181055100 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with th recombinant Human sPLA2-IIA.

Amino Acid Sequence

The immunization antigen (15.8 kDa) is a protein containing 140 AA of recombinant Human sPLA2-IIA. N-Terminal His-tag, 16 extra AA.

MRGSHHHHHHGMASHMNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTKFLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATCFARNKTTYNKKYQYYSNKHCRGSTPRC

The amino acid sequence of the recombinant Human Secreted Phospholipase A2-IIA is 100% homologous to the amino acid sequence of the Human Secreted Phospholipase A2-IIA without signal sequence

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human sPLA2-IIA.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Product References (3)

References

  • Tajuddin N, Kim HY, Collins MA. PARP Inhibition Prevents Ethanol-Induced Neuroinflammatory Signaling and Neurodegeneration in Rat Adult-Age Brain Slice Cultures. J Pharmacol Exp Ther. 2018 Apr;365(1):117-126. doi: 10.1124/jpet.117.245290. Epub 2018 Jan 16. PubMed PMID: 29339456. PubMed CentralPMCID: PMC5830636. See more on PubMed
  • Xiang Y, Chen L, Liu H, Liu X, Wei X, Sun B, Wang T, Zhang X. Inhibition of sPLA₂-IIA prevents LPS-induced neuroinflammation by suppressing ERK1/2-cPLA₂α pathway in mice cerebral cortex. PLoS One. 2013 Oct 9;8(10):e77909. doi: 10.1371/journal.pone.0077909. eCollection 2013. PubMed PMID: 24130900. PubMed CentralPMCID: PMC3793966. See more on PubMed
  • Brekke SI, Kristansen BB, Skauge IJ, Flottorp TM. [Functions of district midwives]. Sykepleien. 1979 Dec 5;66(19):29-31. PubMed PMID: 260378. See more on PubMed
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít