Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

WAP four-disulfide core domain protein 2 Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Epididymal secretory protein E4, Major epididymis-specific protein E4, Putative protease inhibitor WAP5, WFDC2, HE4, WAP5, Epididymis protein 4, Whey-acidic-protein
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172369100 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 104 AA. MW: 11.3 kDa (calculated). UniProtKB acc.no. Q14508 (Glu31-Phe124). N-terminal 10 extra AA. Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

MKHHHHHHASEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

Source

E. coli

Purity

Purity as determined by densitometric image analysis: >95%

SDS-PAGE Gel

14 % SDS-PAGE separation of Human HE4:
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5 μg/lane
3. non-reduced and non-boiled sample, 2.5 μg/lane

Endotoxin

< 1.0 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in PBS buffer, pH 7.5, 4%mannitol, 1%sucrose

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Oncology

Summary

Human epididymis protein 4 (HE4), also called whey-acidic-protein (WAP) four-disulfide core domain protein 2 (WFDC2) is a secreted 25 kDa glycoprotein, a member of the WAP family, initially described to have tissue specific expression in the epididymis. Clinical research in the last decade revealed that HE4 is expressed in a limited number of other organs, including female reproductive tract, breast tissue, kidney, regions of the respiratory tract and nasopharynx. The gene encoding HE4, WFDC2, is composed by six exons. Five HE4 isoforms have been identified and recognized to define specific patterns differently expressed in neoplasm and normal tissues. Under physiologic conditions, HE4 is reported as protease inhibitor playing a crucial role in sperm maturation. The protein contains a WAP domain (4-disulfide core domain 2), which is known to occur in antiproteinases and proteins involved in the innate immune defense of multiple epithelia. Some studies have reported a potential role in the innate immunity of the oral cavity and respiratory tract. In pathophysiology, HE4 is likely involved in cancer progression and metastases. The protein is highly over expressed in epithelial ovarian cancer (EOC) compared to normal ovarian epithelium which is in agreement with clinical studies showing up regulation of HE4 levels in women with EOC. Since its clinical relevance has been confirmed, the HE4 is a biomarker for the detection of ovarian cancer in women with an ovarian cyst or pelvic mass as part of the Risk of Ovarian Malignancy Algorithm (ROMA) and for monitoring women diagnosed with EOC. Amongst the newly proposed biomarkers for ovarian cancer, serum human epididymis protein 4 shows the greatest potential for clinical use.

Summary References (6)

References to WAP four-disulfide core domain protein 2

  • Ferraro S, Schiumarini D, Panteghini M. Human epididymis protein 4: factors of variation. Clin Chim Acta. 2015 Jan 1;438:171-7
  • Hellstrom I, Heagerty PJ, Swisher EM, Liu P, Jaffar J, Agnew K, Hellstrom KE. Detection of the HE4 protein in urine as a biomarker for ovarian neoplasms. Cancer Lett. 2010 Oct 1;296 (1):43-8
  • Hellstrom I, Raycraft J, Hayden-Ledbetter M, Ledbetter JA, Schummer M, McIntosh M, Drescher C, Urban N, Hellstrom KE. The HE4 (WFDC2) protein is a biomarker for ovarian carcinoma. Cancer Res. 2003 Jul 1;63 (13):3695-700
  • Moore RG, Hill EK, Horan T, Yano N, Kim K, MacLaughlan S, Lambert-Messerlian G, Tseng YD, Padbury JF, Miller MC, Lange TS, Singh RK. HE4 (WFDC2) gene overexpression promotes ovarian tumor growth. Sci Rep. 2014;4:3574
  • Van Gorp T, Cadron I, Despierre E, Daemen A, Leunen K, Amant F, Timmerman D, De Moor B, Vergote I. HE4 and CA125 as a diagnostic test in ovarian cancer: prospective validation of the Risk of Ovarian Malignancy Algorithm. Br J Cancer. 2011 Mar 1;104 (5):863-70
  • Yang Z, Luo Z, Zhao B, Zhang W, Zhang J, Li Z, Li L. Diagnosis and preoperative predictive value of serum HE4 concentrations for optimal debulking in epithelial ovarian cancer. Oncol Lett. 2013 Jul;6 (1):28-34
Related Products Docs