Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Apolipoprotein D Human HEK293

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:HEK293
  • Other names:Apo D
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD172118100-HEK 0.1 mg
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 175 AA. MW: 20.1 kDa (calculated). UniProtKB acc. No. P05090 (Gln21-Ser189). C-terminal His-tag (6 extra AA). Protein identity confirmed by LC-MS/MS.

Amino Acid Sequence

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSHHHHHH

Source

HEK293

Purity

Purity as determined by densitometric image analysis: > 80 %

SDS-PAGE Gel

12% SDS-PAGE separation of Human Apo D (HEK)
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and boiled sample, 2.5μg/lane
3. non-reduced and non-boiled sample, 2.5μg/lane

Endotoxin

< 0.1 EU/ug

Formulation

Filtered (0.4 μm) and lyophilized in 0.05 M phosphate buffer, 0.075 M NaCl, pH 7.4

Reconstitution

Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.

Applications

Western blotting, ELISA, Cell culture and/or animal studies

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at –80 °C. Lyophilized protein remains stable until the expiry date when stored at –80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

LAL to determine quantity of endotoxin.

Note

This product is intended for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Lipoprotein metabolism

Summary

Human ApoD is a glycoprotein of 169 amino acids, which was discovered in plasma as an atypical lipoprotein. There, ApoD is peripherally associated with HDL via disulfide bond with ApoA-II , which itself forms an amphipathic a-helical belt that wraps around the lipid disc . ApoD was also isolated as a progesteronebinding protein abundant in mammary gross cystic disease fluid and it was found as a monomeric protein in apocrine secretion, where it seems to bind odorants. ApoD mRNA is expressed in a variety of organs as well as in certain human cancers. Indeed, ApoD has received attention as prognostic marker for various, often steroid-responsive tumors, including prostate cancer , breast carcinoma, and cutaneous malignant melanoma. In addition, ApoD is synthesized by astrocytes in the central nervous systém and there it seems to be involved in arachidonic acid transport, metabolism, and signaling. Notably, ApoD plays a well documented pathophysiological role in several psychiatric disorders , especially in schizophrenia.

Summary References (5)

References to Apolipoprotein D

  • Do Carmo S, Forest JC, Giguere Y, Masse A, Lafond J, Rassart E. Modulation of Apolipoprotein D levels in human pregnancy and association with gestational weight gain. Reprod Biol Endocrinol. 2009;7:92
  • Do Carmo S, Fournier D, Mounier C, Rassart E. Human apolipoprotein D overexpression in transgenic mice induces insulin resistance and alters lipid metabolism. Am J Physiol Endocrinol Metab. 2009 Apr;296 (4):E802-11
  • Eichinger A, Nasreen A, Kim HJ, Skerra A. Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein D. J Biol Chem. 2007 Oct 19;282 (42):31068-75
  • Perdomo G, Henry Dong H. Apolipoprotein D in lipid metabolism and its functional implication in atherosclerosis and aging. Aging (Albany NY). 2009 Jan;1 (1):17-27
  • Rassart E, Bedirian A, Do Carmo S, Guinard O, Sirois J, Terrisse L, Milne R. Apolipoprotein D. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2):185-98
Related Products Docs