United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Apolipoprotein D Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Apo D
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD181118100 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human Apolipoprotein D.

Amino Acid Sequence

The immunization antigen (19.82 kDa – calculated) is a protein containing 174 AA of recombinant Human Apolipoprotein D. C-terminal His-tag, 7 extra AA. The amino acid sequence of this product corresponds to the UniProtKB/Swiss-Prot entry P05090 (Human ApoD). Following modifications were made: Four amino acid exchanges were introduced at the surface of ApoD (Trp99His, Cys116Ser, Ile118Ser, Leu120Ser) to enhance the solubility of the recombinant protein and another three (Leu23Pro, Pro133Val, Asn134Ala) to facilitate its genetic manipulation.

FHLGKCPNPPVQENFDVNKYPGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYHILATDYENYALVYSCTSISQSFHVDFAWILARNVALPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSAHHHHHH

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Apolipoprotein D.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Energy metabolism and body weight regulation, Lipoprotein metabolism

Summary

Human ApoD is a glycoprotein of 169 amino acids, which was discovered in plasma as an atypical lipoprotein. There, ApoD is peripherally associated with HDL via disulfide bond with ApoA-II , which itself forms an amphipathic a-helical belt that wraps around the lipid disc . ApoD was also isolated as a progesteronebinding protein abundant in mammary gross cystic disease fluid and it was found as a monomeric protein in apocrine secretion, where it seems to bind odorants. ApoD mRNA is expressed in a variety of organs as well as in certain human cancers. Indeed, ApoD has received attention as prognostic marker for various, often steroid-responsive tumors, including prostate cancer , breast carcinoma, and cutaneous malignant melanoma. In addition, ApoD is synthesized by astrocytes in the central nervous systém and there it seems to be involved in arachidonic acid transport, metabolism, and signaling. Notably, ApoD plays a well documented pathophysiological role in several psychiatric disorders , especially in schizophrenia.

Product References (1)

References

  • Sałkowska A, Karaś K, Karwaciak I, Walczak-Drzewiecka A, Krawczyk M, Sobalska-Kwapis M, Dastych J, Ratajewski M. Identification of Novel Molecular Markers of Human Th17 Cells. Cells. 2020 Jul 3;9(7):1611. doi: 10.3390/cells9071611. PubMed PMID: 32635226. PubMed CentralPMCID: PMC7407666. See more on PubMed
Summary References (5)

References to Apolipoprotein D

  • Do Carmo S, Forest JC, Giguere Y, Masse A, Lafond J, Rassart E. Modulation of Apolipoprotein D levels in human pregnancy and association with gestational weight gain. Reprod Biol Endocrinol. 2009;7:92
  • Do Carmo S, Fournier D, Mounier C, Rassart E. Human apolipoprotein D overexpression in transgenic mice induces insulin resistance and alters lipid metabolism. Am J Physiol Endocrinol Metab. 2009 Apr;296 (4):E802-11
  • Eichinger A, Nasreen A, Kim HJ, Skerra A. Structural insight into the dual ligand specificity and mode of high density lipoprotein association of apolipoprotein D. J Biol Chem. 2007 Oct 19;282 (42):31068-75
  • Perdomo G, Henry Dong H. Apolipoprotein D in lipid metabolism and its functional implication in atherosclerosis and aging. Aging (Albany NY). 2009 Jan;1 (1):17-27
  • Rassart E, Bedirian A, Do Carmo S, Guinard O, Sirois J, Terrisse L, Milne R. Apolipoprotein D. Biochim Biophys Acta. 2000 Oct 18;1482 (1-2):185-98
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít