United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Apolipoprotein M Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Apo M, Protein G3a, G3a, G3A, NG20
  • Species:Human
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD184129100 0.1 mg $277 / $243 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

ELISA

Source of Antigen

HEK293

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human Apolipoprotein M.

Amino Acid Sequence

The immunization antigen (20 kDa – calculated) is a protein containing 179 AA of recombinant Human Apolipoprotein M. UniProt entry O95445. N-Terminal Flag-tag 13 extra AA.

HVDYKDDDDKPAGCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Apolipoprotein M.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

SDS PAGE - to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Energy metabolism and body weight regulation, Immune Response, Infection and Inflammation, Lipoprotein metabolism

Summary

Human Apolipoprotein M (ApoM, protein G3a, NG20-like protein NG20), is a protein that in humans is encoded by the APOM gene. Two different isoforms have been found for this gene. ApoM is a secreted 25kDa member of the lipocalin protein family consisting of 188 amino acids. Human APOM shares sequence identity with pig (91%) and mouse (80%) APOM. The apolipoproteins are a structurally-unrelated group of proteins that all have some role in the transport of lipids in blood. Apolipoproteins plus phospholipids, cholesterol and triglycerides, form spherical particles with a lipid/hydrophobic center and a (apolipo)protein coat. The apolipoprotein coat promotes aqueous solubility and serves as a ligand for lipoprotein receptors. HDL may contain apoliporoteins A,C, D,E, J, L and M, while LDL contains apolipoproteins B and E. Areas of investigation: Lipoprotein metabolism, Obesity, Atherosclerosis, Diabetes mellitus, Immune Response, Infection and Inflammation.

Related Products Docs