Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

Cystatin C (E.coli) Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Post G-globulin, Cystatin-3, Neuroendocrine basic polypeptide, Gamma-trace, Post-gamma-globulin, CST3
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD181009100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human Cystatin C.

Amino Acid Sequence

The immunization antigen (14.5 kDa) is a protein containing 129 AA of recombinant Human Cystatin C. N-terminal His-tag, 9 extra AA (highlighted).

MKHHHHHHASSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Species Reactivity

Human

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Cystatin C.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Neural tissue markers, Renal disease

Summary

Cystatin C is a non-glycosilated basic single-chain protein consisting of 120 amino acids with a molecular weight of 13.36 kDa and is characterized by two disulfide bonds in the carboxy-terminal region. It belongs to the cystatins superfamilly which inactivates lysosomal cysteine proteinases, e.g. cathepsin B, H,.K, L and S. Imbalance between Cystatin C and cysteine proteinases is associated with inflammation, renal failure, cancer, Alzheimer's di­sease, multiple sclerosis and hereditary Cystatin C amyloid angiopathy. Its increased level has been found in patients with autoimune diseases, with colorectal tumors and in patients on dyalisis. Serum Cystatin C seems to be better marker of glomerular filtration rate than creatinine. On the other hand, low concentration of Cystatin C presents a risk factor for secondary cardiovascular events.

Product References (1)

References

  • McFarland DC, Velleman SG, Pesall JE, Liu C. The role of myostatin in chicken (Gallus domesticus) myogenic satellite cell proliferation and differentiation. Gen Comp Endocrinol. 2007 May 1;151(3):351-7. doi: 10.1016/j.ygcen.2007.02.006. Epub 2007 Feb 12. PubMed PMID: 17362950. See more on PubMed
Summary References (20)

References to Cystatin C

  • Bokenkamp A, Domanetzki M, Zinck R, Schumann G, Byrd D, Brodehl J. Cystatin C--a new marker of glomerular filtration rate in children independent of age and height. Pediatrics. 1998 May;101 (5):875-81
  • Delanaye P, Cavalier E, Krzesinski JM. Cystatin C, renal function, and cardiovascular risk. Ann Intern Med. 2008 Feb 19;148 (4):323
  • Deng A, Irizarry MC, Nitsch RM, Growdon JH, Rebeck GW. Elevation of cystatin C in susceptible neurons in Alzheimer's disease. Am J Pathol. 2001 Sep;159 (3):1061-8
  • Dharnidharka VR, Kwon C, Stevens G. Serum cystatin C is superior to serum creatinine as a marker of kidney function: a meta-analysis. Am J Kidney Dis. 2002 Aug;40 (2):221-6
  • Ekiel I, Abrahamson M, Fulton DB, Lindahl P, Storer AC, Levadoux W, Lafrance M, Labelle S, Pomerleau Y, Groleau D, LeSauteur L, Gehring K. NMR structural studies of human cystatin C dimers and monomers. J Mol Biol. 1997 Aug 15;271 (2):266-77
  • Luc G, Bard JM, Lesueur C, Arveiler D, Evans A, Amouyel P, Ferrieres J, Juhan-Vague I, Fruchart JC, Ducimetiere P. Plasma cystatin-C and development of coronary heart disease: The PRIME Study. Atherosclerosis. 2006 Apr;185 (2):375-80
  • Macisaac RJ, Tsalamandris C, Thomas MC, Premaratne E, Panagiotopoulos S, Smith TJ, Poon A, Jenkins MA, Ratnaike SI, Power DA, Jerums G. Estimating glomerular filtration rate in diabetes: a comparison of cystatin-C- and creatinine-based methods. Diabetologia. 2006 Jul;49 (7):1686-9
  • Mojiminiyi OA, Abdella N. Evaluation of cystatin C and beta-2 microglobulin as markers of renal function in patients with type 2 diabetes mellitus. J Diabetes Complications. 2003 May-Jun;17 (3):160-8
  • Moran A, Katz R, Smith NL, Fried LF, Sarnak MJ, Seliger SL, Psaty B, Siscovick DS, Gottdiener JS, Shlipak MG. Cystatin C concentration as a predictor of systolic and diastolic heart failure. J Card Fail. 2008 Feb;14 (1):19-26
  • Muntner P, Mann D, Winston J, Bansilal S, Farkouh ME. Serum cystatin C and increased coronary heart disease prevalence in US adults without chronic kidney disease. Am J Cardiol. 2008 Jul 1;102 (1):54-7
  • Muntner P, Winston J, Uribarri J, Mann D, Fox CS. Overweight, obesity, and elevated serum cystatin C levels in adults in the United States. Am J Med. 2008 Apr;121 (4):341-8
  • Mussap M, Plebani M. Biochemistry and clinical role of human cystatin C. Crit Rev Clin Lab Sci. 2004;41 (5-6):467-550
  • Nakashima I, Fujinoki M, Fujihara K, Kawamura T, Nishimura T, Nakamura M, Itoyama Y. Alteration of cystatin C in the cerebrospinal fluid of multiple sclerosis. Ann Neurol. 2007 Aug;62 (2):197-200; discussion 205
  • Ortiz F, Harmoinen A, Paavonen T, Koskinen P, Gronhagen-Riska C, Honkanen E. Is Cystatin C more sensitive than creatinine in detecting early chronic allograft nephropathy?. Clin Nephrol. 2008 Jul;70 (1):18-25
  • Parikh NI, Hwang SJ, Yang Q, Larson MG, Guo CY, Robins SJ, Sutherland P, Benjamin EJ, Levy D, Fox CS. Clinical correlates and heritability of cystatin C (from the Framingham Offspring Study). Am J Cardiol. 2008 Nov 1;102 (9):1194-8
  • Perlemoine C, Beauvieux MC, Rigalleau V, Baillet L, Barthes N, Derache P, Gin H. Interest of cystatin C in screening diabetic patients for early impairment of renal function. Metabolism. 2003 Oct;52 (10):1258-64
  • Premaratne E, MacIsaac RJ, Finch S, Panagiotopoulos S, Ekinci E, Jerums G. Serial measurements of cystatin C are more accurate than creatinine-based methods in detecting declining renal function in type 1 diabetes. Diabetes Care. 2008 May;31 (5):971-3
  • Risch L, Blumberg A, Huber A. Rapid and accurate assessment of glomerular filtration rate in patients with renal transplants using serum cystatin C. Nephrol Dial Transplant. 1999 Aug;14 (8):1991-6
  • Samouilidou EC, Grapsa E. Relationship of serum cystatin C with C-reactive protein and apolipoprotein A1 in patients on hemodialysis. Ren Fail. 2008;30 (7):711-5
  • Servais A, Giral P, Bernard M, Bruckert E, Deray G, Isnard Bagnis C. Is serum cystatin-C a reliable marker for metaboli
Related Products Docs