United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Fibroblast Growth Factor 19 Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:FGF-19, UNQ334/PRO533
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD181107100 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits against recombinant Human FGF-19.

Amino Acid Sequence

The immunization antigen (23 kDa) is a protein containing 206 AA of recombinant Human FGF-19. N-terminal His-tag, 14 extra AA.

MRGSHHHHHHGMASLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human FGF-19.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

SDS PAGE - to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Energy metabolism and body weight regulation

Summary

The FGFs are a family of more than 20 small (~17–26 kDa) secreted peptides. The initial characterization of these proteins focused on their ability to stimulate fibroblast proliferation. This mitogenic activity was mediated through FGF receptors (FGFRs) 1, 2, or 3. A fourth closely related tyrosine kinase receptor (FGFR4) was able to bind the FGFs but did not lead to a mitogenic response. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs): FGFR-1, –2, –3, and –4, all with intrinsic tyrosine kinase activity and, except for FGFR-4, multiple splice isoforms, and FGFR-5, which lacks an intracellular kinase domain. There is growing evidence that FGFRs can be important for regulation of glucose and lipid homeostasis. The overexpression of a dominant negative form of FGFR-1 in β cells leads to diabetes in mice, which thus implies that proper FGF signaling is required for normal β cell function and glycemia maintenance. FGFR-2 appears to be a key molecule during pancreatic development. Moreover, FGFR-4 has been implicated in cholesterol metabolism and bile acid synthesis. FGF-19, has been shown to cause resistance to diet-induced obesity and insulin desensitization and to improve insulin, glucose, and lipid profiles in diabetic rodents. Since these effects, at least in part, are mediated through the observed changes in metabolic rates, FGF-19 can be considered as a regulator of energy expenditure. FGF-21 is preferentially expressed in liver, but an exact knowledge of FGF-21 bioactivity and its mode of action have been lacking to date. FGF-21 is a potent activator of glucose uptake on adipocytes, protects animals from diet-induced obesity when overexpressed in transgenic mice, and lowers blood glucose and triglyceride levels when therapeutically administered to diabetic rodents.

Summary References (8)

References to Fibroblast Growth Factor 19

  • Shih DM, Kast-Woelbern HR, Wong J, Xia Y-R, Edwards PA and Lusis AJ: A role for FXR and human FGF-19 in the repression of paraoxonas1 gene expression by bile acids.Journal of Lipid Research 47, 384–392 (2006)
  • Lundasen T, Galman C, Angelin B. and Rudling M: Circulating intestinal fibroblast growth factor 19 has a pronounced diurnal variation and modulates hepatic bile acid synthesis in man.Journal of Internal Medicine 260, 530–536 (2006)
  • Kurose H, Okamoto M, Shimizu M, Bito T, Marcelle C, Noji S and Ohuchi H: FGF-19-FGFR4 signaling elaborates lends induction with the FGF8-L-Maf cascade in the chick embryo.Develop. Growth Differ. 47, 213–223 (2005)
  • Fu L, John LM, Adams SH, Yu XX, Tomlinson E, Renz M, Williams PM, Soriano R, Corpuz R, Moffat B, Vandlen R, Simmons L, Foster J, Stephan JP, Tsai SP, Stewart TA: Fibroblast growth factor 19 increases metabolic rate and reverses dietary and leptin-deficient diabetes.Endocrinology 145, 2594–2603 (2004)
  • Strack AM and Myers RW: Modulation of metabolic syndrome by fibroblast growth factor 19 (FGF-19)? Endocrinology 145, 2591–2593 (2004), Review
  • Holt JA, Luo G, Billin AN, Bisi J, McNeill YY, Kozarsky KF, Donahee M, Wang DY, Mansfield TA, Kliewer SA, Goodwin B and Jones SA: Definition of a novel growth factor-dependent signal cascade for the suppression of bile acid biosynthesis.Genes and Development 17, 1581–1591 (2003)
  • Tomlinson E, Fu L, John L, Hultgren B, Huang X, Renz M, Stephan JP, Tsai SP, Powell-Braxton L, French D and Stewart TA: Transgenic mice expressing human fibroblast grwth factor-19 display increased metabolic rate and decreased adiposity.Endocrinology 143, 1741–1747 (2002)
  • Ornitz DM and Itoh N: Fibroblast growth factors.Genome Biology 2(3), 3005.1–3005.12 (2001), Review
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít