United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:FABP3, Fatty acid-binding protein 3, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP, FABP11, FABP3, Fatty acid-binding protein 3, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP, FABP11
  • Species:Human
United States orders are shipped from our US branch, BioVendor, LLC
Cat. No. Size Price
1 pc / 2 - 5 pcs / 6+ pcs


RD181247100 0.1 mg $300 / $266 / On request
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Source of Antigen

E. coli

Hosts

Rabbit

Isotype

IgG

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human FABP3.

Amino Acid Sequence

The immunization antigen (15.97 kDa) is a protein containing 142 AA of recombinant Human FABP3. N-Terminal His-tag- 10 extra AA. UniProtKB acc.no. P05413.

MKHHHHHHASVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human FABP3.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. 

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

SDS PAGE - to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Cardiovascular disease, Energy metabolism and body weight regulation, Renal disease

Summary References (12)

References to Heart Fatty Acid Binding Protein

  • Pelsers MMAL, Hanhoff T, Van der Voort D, Arts B, Peters M, Ponds R, Honig A, Rudzinski W, Spener F, de Kruijk JR, Twijnstra A, Hermens W, Menheere PPCA, Glatz JFC: Brain and heart type fatty acid-binding proteins in the brain: Tissue distribution and clinical utility. Clin Chem 2004, 50(9):1568-1575
  • Cavus U, Coskum F, Yavuz B, Ciftci O, Sahiner L, Aksoy H, Deniz A, Ozakin E, Aytemir K, Tokgozoglu L, Kabakci G: Heart-type, fatty-acid binding protein can be a diagnostic marker in acute coronary syndrome. J Nat Med Ass 2006, 98(7):1067-1070
  • Storch J, McDermott L: Structural and functional analysis of fatty acid-binding proteins. J Lipid Res 2009, S126-S131
  • Hussain T, Shu LY, Sosorburam T: Importance of cardiac FABP as diagnostic marker of ischaemic heart injury in conjuction with chronic liver disease: A cohort study. Australian Medical J 2010, 3(11):691-694
  • Li Ch, Li J, Liang X, Li X, Cui J, Yang Z, Guo Q, Cao K, Huang J: Point-of-care test of heart-type fatty acid-binding protein for the diagnosis of early acute myocardial infarction. Acta Pharmacologica Sinica 2010, 31:307-312
  • Gururajan P, Gurumurthy P, Nayar P, Rao GSN, Babu S, Cherian KM: Heart fatty acid binding protein (H-FABP) as a diagnostic biomarker in patients with acute coronary syndrome. Heart, Lung and Circulation 2010, 19:660-664
  • Karbek B, Ozbek M, Bozkurt NC, Ginis Z, Gungunes A, Unsal IO, Cakal E, Delibasi T: Heart-type fatty acid binding protein (H-FABP): relationship with arterial intima-media thickness and role as diagnostic marker for atherosclerosis in patients with impaired glucose metabolism. Cardiovasc Diabet 2011, 10:37
  • Elmadbouh I, Mahfouz, Bayomy N, Faried W, Ghanayem N: The value of human heart-type fatty acid binding protein in diagnosis of patients with acute chest pain. The Egypt Heart J 2012, 64:179-184
  • Erenler AK, Yardan T, Duran L, Baydin A: Usefulness of heart-type fatty acid binding protein in the emergency department. J Pak Med Assoc 2013, 63(9):1176-1181
  • Willemsen RTA, Buntinx F, Winkens B, Glatz JF, Dinant GJ, RAPIDA-study team): The value of signs, symptoms and plasma heart-type fatty acid-binding protein (H-FABP) in evaluating patients presenting with symptoms possibly matching acute coronary syndrome: background and methods of a diagnostic study in primary care. BMC Family Pract 2014, 15:203
  • Pyati AK, devaranavadagi BB, Sajjannar SL, Nikam SV, Shannaway M, Sudharani: Heart-type fatty acid binding protein: a better cardiac biomarker than CK-MB and myoglobin in the early diagnosis of acute myocardial infarction. J Clin Diagn Research 2015, 9(10):BC08-BC11
  • Hoffmann U, Espeter F, Weis C, Ahmad-Nejad P, Lang S, Brueckmann M, Akin I, Neumaier M, Borggrefe M, Behnes M: Ischemic heart-type fatty acid binding protein (hFABP) in acute
Related Products Docs
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
Subscribe to Our Newsletter! Discover News from
BioVendor R&D
Subscribe Now
zavřít