Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Osteoblast Specific Factor 2 Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Periostin, PN, OSF-2, POSTN, Fasciclin-I like, Osteoblast Specific Factor 2 (Pleiotrophin, PTN, Heparin-binding growth-associated molecule, HB-GAM, Heparin-binding growth factor 8, HBGF-8, OSF-2, Heparin-binding neurite outgrowth-promoting factor 2, HBNF-2, Heparin-binding brain mitogen, HBBM ), NCK
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD181045050 0.05 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human OSF-2.

Amino Acid Sequence

The immunization antigen (75 kDa) is a protein containing 648 AA of recombinant Human OSF-2 and 23 AA, N-Terminal HisTag and Xa – cleavage site (highlighted). The antigen contains amino acid residues 22 to 669 of the human OSF-2 precursor. The antigen includes all four fasciclin domains of OSF-2.

MGHHHHHHHHHHSSGHIEGRHMRNNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERFMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSMVQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVY

Species Reactivity

Human, Rat, Chicken, Mouse. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human OSF-2.

Antibody Content

0.05 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Bone and cartilage metabolism, Cardiovascular disease, Cytokines and chemokines and related molecules, Oncology

Summary

Periostin is a disulfide linked 90 kDa, 811 amino acid protein originally isolated as a osteoblast-specific factor that functions as a cell adhesion molecule for preosteoblasts and is thought to be involved in osteoblast recruitment, attachment and spreading. Additionally, periostin expression has previously been shown to be significantly increased by both transforming growth factor beta-1(TGFbeta1) and bone morphogenetic protein (BMP-2). OSF-2 has a typical signal sequence, followed by a cysteine-rich domain, a fourfold repeated domain and a C-terminal domain. The fourfold repeated domain of OSF-2 shows homology with the insect protein fasciclin Periostin mRNA is expressed in the developing mouse embryonic and fetal heart, and that it is localized to the endocardial cushions that ultimately divide the primitive heart tube into a four-chambered heart.

Product References (26)

References

  • Bagnato C, Thumar J, Mayya V, Hwang SI, Zebroski H, Claffey KP, HaudenschildC, Eng JK, Lundgren DH, Han DK. Proteomics analysis of human coronaryatherosclerotic plaque: a feasibility study of direct tissue proteomics by liquidchromatography and tandem mass spectrometry. Mol Cell Proteomics. 2007Jun;6(6):1088-102. Epub 2007 Mar 5. PubMed PMID: 17339633. See more on PubMed
  • Blanchard C, Mingler MK, McBride M, Putnam PE, Collins MH, Chang G, StringerK, Abonia JP, Molkentin JD, Rothenberg ME. Periostin facilitates eosinophiltissue infiltration in allergic lung and esophageal responses. Mucosal Immunol.2008 Jul;1(4):289-96. doi: 10.1038/mi.2008.15. Epub 2008 May 7. PubMed PMID:19079190; PubMed Central PMCID: PMC2683986. See more on PubMed
  • Blumer MJ, Schwarzer C, Pérez MT, Konakci KZ, Fritsch H. Identification andlocation of bone-forming cells within cartilage canals on their course into thesecondary ossification centre. J Anat. 2006 Jun;208(6):695-707. PubMed PMID:16761972; PubMed Central PMCID: PMC2100231. See more on PubMed
  • Castronovo V, Waltregny D, Kischel P, Roesli C, Elia G, Rybak JN, Neri D. Achemical proteomics approach for the identification of accessible antigensexpressed in human kidney cancer. Mol Cell Proteomics. 2006 Nov;5(11):2083-91.Epub 2006 Jul 21. PubMed PMID: 16861259. See more on PubMed
  • Erkan M, Kleeff J, Gorbachevski A, Reiser C, Mitkus T, Esposito I, Giese T,Büchler MW, Giese NA, Friess H. Periostin creates a tumor-supportivemicroenvironment in the pancreas by sustaining fibrogenic stellate cell activity.Gastroenterology. 2007 Apr;132(4):1447-64. Epub 2007 Jan 25. PubMed PMID:17408641. See more on PubMed
  • Gao BB, Stuart L, Feener EP. Label-free quantitative analysis ofone-dimensional PAGE LC/MS/MS proteome: application on angiotensin II-stimulated smooth muscle cells secretome. Mol Cell Proteomics. 2008 Dec;7(12):2399-409. doi:10.1074/mcp.M800104-MCP200. Epub 2008 Aug 2. PubMed PMID: 18676994; PubMedCentral PMCID: PMC2596345. See more on PubMed
  • Grigoriadis A, Mackay A, Reis-Filho JS, Steele D, Iseli C, Stevenson BJ,Jongeneel CV, Valgeirsson H, Fenwick K, Iravani M, Leao M, Simpson AJ, StrausbergRL, Jat PS, Ashworth A, Neville AM, O'Hare MJ. Establishment of theepithelial-specific transcriptome of normal and malignant human breast cellsbased on MPSS and array expression data. Breast Cancer Res. 2006;8(5):R56. PubMedPMID: 17014703; PubMed Central PMCID: PMC1779497. See more on PubMed
  • Hakuno D, Kimura N, Yoshioka M, Mukai M, Kimura T, Okada Y, Yozu R, Shukunami C, Hiraki Y, Kudo A, Ogawa S, Fukuda K. Periostin advances atherosclerotic andrheumatic cardiac valve degeneration by inducing angiogenesis and MMP production in humans and rodents. J Clin Invest. 2010 Jul;120(7):2292-306. doi:10.1172/JCI40973. Epub 2010 Jun 14. Erratum in: J Clin Invest. 2011 Jan4;121(1):454. PubMed PMID: 20551517; PubMed Central PMCID: PMC2898587. See more on PubMed
  • Hosoya A, Nakamura H, Ninomiya T, Yoshiba K, Yoshiba N, Nakaya H, Wakitani S, Yamada H, Kasahara E, Ozawa H. Immunohistochemical localization of alpha-Smoothmuscle actin during rat molar tooth development. J Histochem Cytochem. 2006Dec;54(12):1371-8. Epub 2006 Aug 21. PubMed PMID: 16924123; PubMed Central PMCID:PMC3958122. See more on PubMed
  • Chamberlain CS, Brounts SH, Sterken DG, Rolnick KI, Baer GS, Vanderby R. Gene profiling of the rat medial collateral ligament during early healing usingmicroarray analysis. J Appl Physiol (1985). 2011 Aug;111(2):552-65. doi:10.1152/japplphysiol.00073.2011. Epub 2011 May 19. PubMed PMID: 21596919; PubMed Central PMCID: PMC3154688. See more on PubMed
  • Kashyap MK, Marimuthu A, Peri S, Kumar GS, Jacob HK, Prasad TS, Mahmood R,Kumar KV, Kumar MV, Meltzer SJ, Montgomery EA, Kumar RV, Pandey A. Overexpressionof periostin and lumican in esophageal squamous cell carcinoma. Cancers (Basel). 2010 Mar 1;2(1):133-42. doi: 10.3390/cancers2010133. PubMed PMID: 24281036;PubMed Central PMCID: PMC3827595. See more on PubMed
  • Kühn B, del Monte F, Hajjar RJ, Chang YS, Lebeche D, Arab S, Keating MT.Periostin induces proliferation of differentiated cardiomyocytes and promotescardiac repair. Nat Med. 2007 Aug;13(8):962-9. Epub 2007 Jul 15. PubMed PMID:17632525. See more on PubMed
  • Kuo CH, Miyazaki D, Nawata N, Tominaga T, Yamasaki A, Sasaki Y, Inoue Y.Prognosis-determinant candidate genes identified by whole genome scanning in eyeswith pterygia. Invest Ophthalmol Vis Sci. 2007 Aug;48(8):3566-75. PubMed PMID:17652725. See more on PubMed
  • Kuo CH, Miyazaki D, Yakura K, Araki-Sasaki K, Inoue Y. Role of periostin andinterleukin-4 in recurrence of pterygia. Invest Ophthalmol Vis Sci. 2010Jan;51(1):139-43. doi: 10.1167/iovs.09-4022. Epub 2009 Aug 6. PubMed PMID:19661231. See more on PubMed
  • Li JS, Sun GW, Wei XY, Tang WH. Expression of periostin and itsclinicopathological relevance in gastric cancer. World J Gastroenterol. 2007 Oct 21;13(39):5261-6. PubMed PMID: 17876898; PubMed Central PMCID: PMC4171309. See more on PubMed
  • Li P, Oparil S, Novak L, Cao X, Shi W, Lucas J, Chen YF. ANP signalinginhibits TGF-beta-induced Smad2 and Smad3 nuclear translocation and extracellularmatrix expression in rat pulmonary arterial smooth muscle cells. J Appl Physiol(1985). 2007 Jan;102(1):390-8. Epub 2006 Oct 12. PubMed PMID: 17038494. See more on PubMed
  • Liang X, Zhao J, Hajivandi M, Wu R, Tao J, Amshey JW, Pope RM. Quantification of membrane and membrane-bound proteins in normal and malignant breast cancercells isolated from the same patient with primary breast carcinoma. J ProteomeRes. 2006 Oct;5(10):2632-41. PubMed PMID: 17022634. See more on PubMed
  • Morra L, Rechsteiner M, Casagrande S, Duc Luu V, Santimaria R, Diener PA,Sulser T, Kristiansen G, Schraml P, Moch H, Soltermann A. Relevance of periostin splice variants in renal cell carcinoma. Am J Pathol. 2011 Sep;179(3):1513-21.doi: 10.1016/j.ajpath.2011.05.035. Epub 2011 Jul 18. PubMed PMID: 21763681;PubMed Central PMCID: PMC3157167. See more on PubMed
  • Riester M, Wei W, Waldron L, Culhane AC, Trippa L, Oliva E, Kim SH, Michor F, Huttenhower C, Parmigiani G, Birrer MJ. Risk prediction for late-stage ovariancancer by meta-analysis of 1525 patient samples. J Natl Cancer Inst. 2014 Apr3;106(5). pii: dju048. doi: 10.1093/jnci/dju048. PubMed PMID: 24700803; PubMedCentral PMCID: PMC4580556. See more on PubMed
  • Satirapoj B, Tassanasorn S, Charoenpitakchai M, Supasyndh O. Periostin as atissue and urinary biomarker of renal injury in type 2 diabetes mellitus. PLoSOne. 2015 Apr 17;10(4):e0124055. doi: 10.1371/journal.pone.0124055. eCollection2015. PubMed PMID: 25884625; PubMed Central PMCID: PMC4401767. See more on PubMed
  • Sen K, Lindenmeyer MT, Gaspert A, Eichinger F, Neusser MA, Kretzler M, SegererS, Cohen CD. Periostin is induced in glomerular injury and expressed de novo ininterstitial renal fibrosis. Am J Pathol. 2011 Oct;179(4):1756-67. doi:10.1016/j.ajpath.2011.06.002. Epub 2011 Aug 18. PubMed PMID: 21854746; PubMedCentral PMCID: PMC3181392. See more on PubMed
  • Soltermann A, Ossola R, Kilgus-Hawelski S, von Eckardstein A, Suter T,Aebersold R, Moch H. N-glycoprotein profiling of lung adenocarcinoma pleuraleffusions by shotgun proteomics. Cancer. 2008 Apr 25;114(2):124-33. doi:10.1002/cncr.23349. PubMed PMID: 18327805. See more on PubMed
  • Utispan K, Thuwajit P, Abiko Y, Charngkaew K, Paupairoj A, Chau-in S, ThuwajitC. Gene expression profiling of cholangiocarcinoma-derived fibroblast revealsalterations related to tumor progression and indicates periostin as a poorprognostic marker. Mol Cancer. 2010 Jan 24;9:13. doi: 10.1186/1476-4598-9-13.PubMed PMID: 20096135; PubMed Central PMCID: PMC2841583. See more on PubMed
  • Wallace DP, Quante MT, Reif GA, Nivens E, Ahmed F, Hempson SJ, Blanco G,Yamaguchi T. Periostin induces proliferation of human autosomal dominantpolycystic kidney cells through alphaV-integrin receptor. Am J Physiol RenalPhysiol. 2008 Nov;295(5):F1463-71. doi: 10.1152/ajprenal.90266.2008. Epub 2008Aug 27. PubMed PMID: 18753297; PubMed Central PMCID: PMC2584901. See more on PubMed
  • Woodruff PG, Boushey HA, Dolganov GM, Barker CS, Yang YH, Donnelly S,Ellwanger A, Sidhu SS, Dao-Pick TP, Pantoja C, Erle DJ, Yamamoto KR, Fahy JV.Genome-wide profiling identifies epithelial cell genes associated with asthma andwith treatment response to corticosteroids. Proc Natl Acad Sci U S A. 2007 Oct2;104(40):15858-63. Epub 2007 Sep 26. PubMed PMID: 17898169; PubMed CentralPMCID: PMC2000427. See more on PubMed
  • Zhang Y, Zhang G, Li J, Tao Q, Tang W. The expression analysis of periostin inhuman breast cancer. J Surg Res. 2010 May 1;160(1):102-6. doi:10.1016/j.jss.2008.12.042. Epub 2009 Feb 27. PubMed PMID: 19524268. See more on PubMed
Summary References (3)

References to Osteoblast Specific Factor 2

  • Horiuchi K, Amizuka N, Takeshita S, Takamatsu H, Katsuura M, Ozawa H, Toyama Y, Bonewald LF, Kudo A. Identification and characterization of a novel protein, periostin, with restricted expression to periosteum and periodontal ligament and increased expression by transforming growth factor beta. J Bone Miner Res. 1999 Jul;14 (7):1239-49
  • Takeshita S, Kikuno R, Tezuka K, Amann E. Osteoblast-specific factor 2: cloning of a putative bone adhesion protein with homology with the insect protein fasciclin I. Biochem J. 1993 Aug 15;294 ( Pt 1):271-8
  • Ulstrup JC, Jeansson S, Wiker HG, Harboe M. Relationship of secretion pattern and MPB70 homology with osteoblast-specific factor 2 to osteitis following Mycobacterium bovis BCG vaccination. Infect Immun. 1995 Feb;63 (2):672-5
Related Products Docs