Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Placental Protein 13 Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:Galactoside-Binding Soluble Lectin 13, Galectin-13, Gal-13, Placental tissue protein 13, PP13, LGALS13, PLAC8
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD181254100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Isotype

IgG

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human Placental Protein 13.

Amino Acid Sequence

Recombinant Human Placental Protein 13, total 149 AA. MW: 17.36 kDa (calculated). UniProtKB acc.no. Q9UHV8. N-Terminal His-tag (10 extra AA)

MKHHHHHHASMSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Placental Protein 13.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Reproduction

Summary

Placental protein 13 (PP13, Galectin 13) is the member of the beta-galactoside binding S-type galectin superfamily, whose members are important in placenta implantation and remodelling of maternal arteries. PP13 binds to beta-galactoside residues of several proteins on the cell surface, cytoskeleton and extracellular matrix, thereby generating various responses such as immune responses and influencing other functions like apoptosis and molecular recognition. PP13, which is predominantly produced by placental tissue, possesses a conserved carbohydrate binding domain, to which two proteins Annexin-II and Actin-beta bind. These proteins are considered to play a key role in placentation and maternal artery remodelling respectively. Human PP13 is a relatively small protein with 139 amino acids and is composed of two identical 16 kDa subunits held together by disulfide bonds. PP13 was first isolated from placenta and especially from the syncytiotrophoblast in 1983 by Bohn et. al. It is localized to the syncytiotrophoblast brush border membrane, and detected in maternal and cord blood. Though it is found primarily in placenta, some PP13 expression was also detected in healthy spleen, kidney and bladder tissue and in liver adenocarcinoma, neurogen tumour and malignant melanoma. The serum levels of PP13 slowly increase during a normal pregnancy but abnormally low levels of PP-13 were detected in first trimester serum samples of women subsequently developing fetal growth restriction and preeclampsia, especially in cases with early onset. Elevated serum concentrations of PP-13 have been found in the second and third trimester in women with preeclampsia, intrauterine growth restriction (IUGR) and in preterm delivery. Another study concluded that first-trimester serum levels of PP13 may serve as a suitable marker for preterm preeclampsia but are weak for the prediction of severe preeclampsia and ineffective for mild preeclampsia at term.

Summary References (10)

References to Placental Protein 13

  • Balogh A, Pozsgay J, Matko J, Dong Z, Kim CJ, Varkonyi T, Sammar M, Rigo J Jr, Meiri H, Romero R, Papp Z, Than NG. Placental protein 13 (PP13/galectin-13) undergoes lipid raft-associated subcellular redistribution in the syncytiotrophoblast in preterm preeclampsia and HELLP syndrome. Am J Obstet Gynecol. 2011 Aug;205 (2):156.e1-14
  • Bohn H, Kraus W, Winckler W. Purification and characterization of two new soluble placental tissue proteins (PP13 and PP17). Oncodev Biol Med. 1983;4 (5):343-50
  • Carty DM, Delles C, Dominiczak AF. Novel biomarkers for predicting preeclampsia. Trends Cardiovasc Med. 2008 Jul;18 (5):186-94
  • Grill S, Rusterholz C, Zanetti-Dallenbach R, Tercanli S, Holzgreve W, Hahn S, Lapaire O. Potential markers of preeclampsia--a review. Reprod Biol Endocrinol. 2009;7:70
  • Huppertz B, Meiri H, Gizurarson S, Osol G, Sammar M. Placental protein 13 (PP13): a new biological target shifting individualized risk assessment to personalized drug design combating pre-eclampsia. Hum Reprod Update. 2013 Jul-Aug;19 (4):391-405
  • Nicolaides KH, Bindra R, Turan OM, Chefetz I, Sammar M, Meiri H, Tal J, Cuckle HS. A novel approach to first-trimester screening for early pre-eclampsia combining serum PP-13 and Doppler ultrasound. Ultrasound Obstet Gynecol. 2006 Jan;27 (1):13-7
  • Orendi K, Gauster M, Moser G, Meiri H, Huppertz B. Effects of vitamins C and E, acetylsalicylic acid and heparin on fusion, beta-hCG and PP13 expression in BeWo cells. Placenta. 2010 May;31 (5):431-8
  • Petla LT, Chikkala R, Ratnakar KS, Kodati V, Sritharan V. Biomarkers for the management of pre-eclampsia in pregnant women. Indian J Med Res. 2013;138:60-7
  • Than NG, Abdul Rahman O, Magenheim R, Nagy B, Fule T, Hargitai B, Sammar M, Hupuczi P, Tarca AL, Szabo G, Kovalszky I, Meiri H, Sziller I, Rigo J Jr, Romero R, Papp Z. Placental protein 13 (galectin-13) has decreased placental expression but increased shedding and maternal serum concentrations in patients presenting with preterm pre-eclampsia and HELLP syndrome. Virchows Arch. 2008 Oct;453 (4):387-400
  • Visegrady B, Than NG, Kilar F, Sumegi B, Than GN, Bohn H. Homology modelling and molecular dynamics studies of human placental tissue protein 13 (galectin-13). Protein Eng. 2001 Nov;14 (11):875-80
Related Products Docs