Regenerating Protein 1 alpha Human, Rabbit Polyclonal Antibody

Cat. No.	Size	Price 1 pc / 2 - 5 pcs / 6+ pcs
RD181078100	0.1 mg	$300 / $266 / On request

Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry, Immunoprecipitation

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human REG-1alpha.

Amino Acid Sequence

The immunization antigen (17.8 kDa) is a protein containing 156 AA of recombinant Human REG-1alpha. N-Terminal His-tag 12 AA.

MKHHHHHHASHMQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN

The amino acid sequence of the recombinant Human REG-1alpha is 100% homologous to the amino acid sequence of the Human REG-1alpha without signal sequence

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human REG-1alpha.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Immune Response, Infection and Inflammation, Oncology, Pancreatic regulatory molecules

Summary

Reg protein was shown to be stimulated during the regeneration of pancreatic islets. Since then, many Reg-related proteins have been identified in humans and other animals. In human, the four REG family genes, i.e., REG 1 alpha, REG 1 beta, REG-related sequence (RS) and HIP/PAP, have so far been isolated. These Reg-related proteins are classified into four subfamilies according to their amino-acid sequences, but they share a similar structure and physiological function. Reg protein is a growth factor for pancreatic beta cells and also suggest that the administration of Reg protein could be used as another therapeutic approach for diabetes mellitus. human REG cDNA which encoded a 166-amino acid protein with a 22-amino acid signal peptide. The amino acid sequence of human REG protein has 68% homology to that of rat Reg protein. Reg I was found to be expressed mainly in pancreatic beta and acinoductular cells as well as gastric fundic enterochromaffin-like (ECL) cells. Reg I production in ECL cells is stimulated by gastrin, as well as by the proinflammatory cytokine, cytokine-induced neutrophil chemoattractant (CINC)-2Beta. In patients with chronic hypergastrinemia, Reg production is stimulated, with the increased proliferation of gastric mucosal cells. Patients with Helicobacter pylori infection also showed increased Reg production in the gastric mucosa, partly via increased plasma gastrin concentration and partly via increased proinflammatory cytokine production. The serum concentration of the reg-protein was significantly higher in patients with various pancreatic diseases than in normal controls, and was also significantly higher in patients with acute pancreatitis or chronic relapsing pancreatitis than in patients with chronic pancreatitis. Furthermore, the serum PSP/reg-protein concentration was also significantly increased in liver cirrhosis, choledocholithiasis, and various cancers of the digestive system.

Product References (2)

References

Minamiya Y, Kawai H, Saito H, Ito M, Hosono Y, Motoyama S, Katayose Y, Takahashi N, Ogawa JI. REG1A expression is an independent factor predictive of poor prognosis in patients with non-small cell lung cancer. Lung Cancer. 2008 Apr;60(1):98-104. doi: 10.1016/j.lungcan.2007.09.012. Epub 2007 Oct 26. PubMed PMID: 17964685. See more on PubMed
Hayashi K, Motoyama S, Sugiyama T, Izumi J, Anbai A, Nanjo H, Watanabe H, Maruyama K, Minamiya Y, Koyota S, Koizumi Y, Takasawa S, Murata K, Ogawa J. REG Ialpha is a reliable marker of chemoradiosensitivity in squamous cell esophageal cancer patients. Ann Surg Oncol. 2008 Apr;15(4):1224-31. doi: 10.1245/s10434-008-9810-8. Epub 2008 Feb 8. PubMed PMID: 18259819. See more on PubMed

Summary References (18)

References to Regenerating Protein 1 alpha

Ashcroft FJ, Varro A, Dimaline R, Dockray GJ. Control of expression of the lectin-like protein Reg-1 by gastrin: role of the Rho family GTPase RhoA and a C-rich promoter element. Biochem J. 2004 Jul 15;381 (Pt 2):397-403
Bartoli C, Baeza N, Figarella C, Pellegrini I, Figarella-Branger D. Expression of peptide-23/pancreatitis-associated protein and Reg genes in human pituitary and adenomas: comparison with other fetal and adult human tissues. J Clin Endocrinol Metab. 1998 Nov;83 (11):4041-6
Bartoli C, Gharib B, Giorgi D, Sansonetti A, Dagorn JC, Berge-Lefranc JL. A gene homologous to the reg gene is expressed in the human pancreas. FEBS Lett. 1993 Aug 2;327 (3):289-93
Boonyasrisawat W, Pulsawat P, Yenchitsomanus PT, Vannasaeng S, Pramukkul P,Deerochanawong C, Sriussadaporn S, Ploybutr S, Pasurakul T, Banchuin N. Analysis of the reg1alpha and reg1beta gene transcripts in patients with fibrocalculous pancreatopathy. Southeast Asian J Trop Med Public Health. 2002 Jun;33(2):365-72.
Carrere J, Guy-Crotte O, Gaia E, Figarella C. Immunoreactive pancreatic Reg protein in sera from cystic fibrosis patients with and without pancreatic insufficiency. Gut. 1999 Apr;44 (4):545-51
de la Monte SM, Ozturk M, Wands JR. Enhanced expression of an exocrine pancreatic protein in Alzheimer's disease and the developing human brain. J Clin Invest. 1990 Sep;86 (3):1004-13
De Reggi M, Gharib B. Protein-X, Pancreatic Stone-, Pancreatic thread-, reg-protein, P19, lithostathine, and now what? Characterization, structural analysis and putative function(s) of the major non-enzymatic protein of pancreatic secretions. Curr Protein Pept Sci. 2001 Mar;2 (1):19-42
Iovanna JL, Dagorn JC. The multifunctional family of secreted proteins containing a C-type lectin-like domain linked to a short N-terminal peptide. Biochim Biophys Acta. 2005 May 25;1723 (1-3):8-18
Kawamata H, Furihata T, Omotehara F, Sakai T, Horiuchi H, Shinagawa Y, Imura J, Ohkura Y, Tachibana M, Kubota K, Terano A, Fujimori T. Identification of genes differentially expressed in a newly isolated human metastasizing esophageal cancer cell line, T.Tn-AT1, by cDNA microarray. Cancer Sci. 2003 Aug;94 (8):699-706
Kiji T, Dohi Y, Takasawa S, Okamoto H, Nonomura A, Taniguchi S. Activation of regenerating gene Reg in rat and human hearts in response to acute stress. Am J Physiol Heart Circ Physio. 2005 Jul;289 (1):H277-84
Kinoshita Y, Ishihara S, Kadowaki Y, Fukui H, Chiba T. Reg protein is a unique growth factor of gastric mucosal cells. J Gastroenterol. 2004 Jun;39(6):507-13.
Norkina O, Graf R, Appenzeller P, De Lisle RC. Caerulein-induced acute pancreatitis in mice that constitutively overexpress Reg/PAP genes. BMC Gastroenterol. 2006;6:16
Okamoto H. The Reg gene family and Reg proteins: with special attention to the regeneration of pancreatic beta-cells. J Hepatobiliary Pancreat Surg. 1999;6(3):254-62.
Qiu L, List EO, Kopchick JJ. Differentially expressed proteins in the pancreas of diet-induced diabetic mice. Mol Cell Proteomics. 2005 Sep;4 (9):1311-8
Shinozaki S, Nakamura T, Iimura M, Kato Y, Iizuka B, Kobayashi M, Hayashi N. Upregulation of Reg 1alpha and GW112 in the epithelium of inflamed colonic mucosa. Gut. 2001 May;48 (5):623-9
Sobajima H, Niwa T, Shikano M, Naruse S, Kitagawa M, Nakae Y, Ishiguro H, Kondo T, Hayakawa T. Urinary excretion of pancreatic stone protein in diabetic nephropathy. Intern Med. 1998 Jun;37 (6):500-3
Unno M, Nata K, Noguchi N, Narushima Y, Akiyama T, Ikeda T, Nakagawa K, Takasawa S, Okamoto H. Production and characterization of Reg knockout mice: reduced proliferation of pancreatic beta-cells in Reg knockout mice. Diabetes. 2002 Dec;51 Suppl 3:S478-83
Yuan RH, Jeng YM, Chen HL, Hsieh FJ, Yang CY, Lee PH, Hsu HC. Opposite roles of human pancreatitis-associated protein and REG1A expression in hepatocellular carcinoma: association of pancreatitis-associated protein expression with low-stage hepatocellular carcinoma, beta-ca

By Research Topic

Diabetology - Other Relevant Products
Immune Response, Infection and Inflammation
Oncology
Pancreatic regulatory molecules

By Molecule

Regenerating Protein 1 alpha

By Technical Data

Regenerating Protein 1 alpha - Antibodies
Regenerating Protein 1 alpha - Polyclonal Antibody - Antibodies
Human - Regenerating Protein 1 alpha - Antibodies
Regenerating Protein 1 alpha - from Rabbit - Antibodies
Regenerating Protein 1 alpha - for Western blotting - Antibodies
Regenerating Protein 1 alpha - for ELISA - Antibodies
Regenerating Protein 1 alpha - for Immunohistochemistry - Antibodies
Regenerating Protein 1 alpha - for Immunoprecipitation - Antibodies
Regenerating Protein 1 alpha - Antigene from E. coli - Antibodies
Polyclonal Antibody - Antibodies
Human - Polyclonal Antibody - Antibodies
Polyclonal Antibody - from Rabbit - Antibodies
Polyclonal Antibody - for Western blotting - Antibodies
Polyclonal Antibody - for ELISA - Antibodies
Polyclonal Antibody - for Immunohistochemistry - Antibodies
Polyclonal Antibody - for Immunoprecipitation - Antibodies
Polyclonal Antibody - Antigene from E. coli - Antibodies
Human - Antibodies
Human - from Rabbit - Antibodies
Human - for Western blotting - Antibodies
Human - for ELISA - Antibodies
Human - for Immunohistochemistry - Antibodies
Human - for Immunoprecipitation - Antibodies
Human - Antigene from E. coli - Antibodies
from Rabbit - Antibodies
from Rabbit - for Western blotting - Antibodies
from Rabbit - for ELISA - Antibodies
from Rabbit - for Immunohistochemistry - Antibodies
from Rabbit - for Immunoprecipitation - Antibodies
from Rabbit - Antigene from E. coli - Antibodies
for Western blotting - Antibodies
for Western blotting - Antigene from E. coli - Antibodies
for ELISA - Antibodies
for ELISA - Antigene from E. coli - Antibodies
for Immunohistochemistry - Antibodies
for Immunohistochemistry - Antigene from E. coli - Antibodies
for Immunoprecipitation - Antibodies
for Immunoprecipitation - Antigene from E. coli - Antibodies
Antigene from E. coli - Antibodies

Docs

Product Datasheet (RUO)

Datasheet PDF (RUO)

Safety Information (RUO)

MSDS (RUO)