Select country set
language
Menu Shopping cart 0,00 Search
Manufactured by BioVendor

S100A9 Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:S100 calcium-binding protein A9, Calgranulin-B, Migration inhibitory factor-related protein 14, MRP-14, p14, Leukocyte L1 complex heavy chain, Calprotectin L1H subunit, CAGB, CFAG
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD184218100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human S100A9.

Amino Acid Sequence

The immunization antigen (14.35 kDa) is a protein containing 123 AA of recombinant Human S100A9. N-Terminal His-tag, 10 extra AA (highlighted).

MKHHHHHHASTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human S100A9.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody BCA - to determine quantity of the antibody

Note

This product is for research use only.

Summary

Research topic

Coronary artery disease, Immune Response, Infection and Inflammation, Pulmonary diseases, Sepsis

Summary

S100A9 is a calcium binding protein. Each S100A9 monomer contains a high affinity calcium binding site at the C-terminus and a low-affinity calcium binding site at the N-terminus. S100A9 may exist as a homodimer, heterodimer with an S100A8 partner (S100A8/A9), or as a heterotetramer with an S100A8 partner (S100A8/A9). S100A9 was first identified in the context of multiple inflammatory reactions which has led to confusing nomenclature in the literature. In 1987, it was found in infiltrating macrophages of rheumatoid arthritis patients and named MRP-14 (myeloid related protein of molecular weight 14 kD). S100A9, a the member of the calcium binding S100 protein family that is also known as MRP14 or Calgranulin B, is an inflammation-associated protein that is constitutively expressed in neutrophils and inducible in numerous inflammatory cells, including macrophages, epithelial cells, and keratinocytes. S100A9 is located in myeloid cells, cancer cells, and in tumor stroma. S100A9 is an abundant cytoplasmic protein in normal myeloid cells such as polymorphonuclear cells and monocytes. It has become clear that S100A9 localizes with its partner S100A8 in many biological processes but may act as a sole player in other cancers. S100A8 and S100A9 are minimally expressed in normal esophageal epithelium, but S100A9 is expressed across the spectrum of Barrett’s esophagus through adenocarcinoma. S100A8 and S100A9 belong to a family of 25 homologous low-molecular-weight intracellular calcium-binding proteins that exhibit tissue and cell-specific expression. They are characterized by two distinct EF-hand (helix-loop-helix) calcium-binding domains connected by a hinge region. The N-terminal Ca 2+ binding domain has lower affinity than the canonical C-terminal domain that allows for functionally important second messenger roles dependent on intracellular Ca 2+ levels. These proteins have been associated with chronic inflammatory diseases such as rheumatoid arthritis (RA), cystic fibrosis, Crohns disease, ulcerative colitis, allergic dermatitis, and infection.

Summary References (4)

References to S100A9

  • Kim HJ, Chang KA, Ha TY, Kim J, Ha S, Shin KY, Moon C, Nacken W, Kim HS, Suh YH. S100A9 knockout decreases the memory impairment and neuropathology in crossbreed mice of Tg2576 and S100A9 knockout mice model. PLoS One. 2014;9 (2):e88924
  • Markowitz J, Carson WE 3rd. Review of S100A9 biology and its role in cancer. Biochim Biophys Acta. 2013 Jan;1835 (1):100-9
  • Passey RJ, Xu K, Hume DA, Geczy CL. S100A8: emerging functions and regulation. J Leukoc Biol. 1999 Oct;66 (4):549-56
  • Srikrishna G. S100A8 and S100A9: new insights into their roles in malignancy. J Innate Immun. 2012;4 (1):31-40
Related Products Docs