United States set
language
Menu Shopping cart $0 Search
Manufactured by BioVendor

Soluble Receptor for Advanced Glycation End Products Human E. coli

  • Regulatory status:RUO
  • Type:Recombinant protein
  • Source:E. coli
  • Other names:Soluble Receptor for Advanced Glycation End Products, sRAGE, Advanced glycation end product-specific receptor, AGER, RAGE
  • Species:Human
Cat. No. Size Price
1 - 4 pcs / 5 - 9 pcs / 10+ pcs


RD172116100 0.1 mg $421 / $370 / On request
PubMed Product Details
Technical Data

Type

Recombinant protein

Description

Total 339 AA. MW: 36.5 kDa. UniProtKB acc.no. Q15109. N-Terminal His-tag 14 AA.

Amino Acid Sequence

MRGSHHHHHHGMASAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGEGFDKVREAEDSPQHM

Source

E. coli

Purity

˃ 90 % by SDS-PAGE

SDS-PAGE Gel

12% SDS-PAGE separation of Human sRAGE
1. M.W. marker – 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5μg/lane
3. non-reduced and non-heated sample, 5μg/lane

Endotoxin

< 1.0 EU/µg

Formulation

Filtered (0.4 μm) and lyophilized in 0.5 mg/mL in 0.03 M acetate buffer, pH=4.0

Reconstitution

Add 0.1 M Acetate buffer pH4 to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/mL. In higher concentrations the solubility of this antigen is limited.

Applications

Western blotting, ELISA

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

Store the lyophilized protein at -80 °C. Lyophilized protein remains stable until the expiry date when stored at -80 °C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80 °C for long term storage. Reconstituted protein can be stored at 4 °C for a week.

Quality Control Test

BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein. Endotoxin level determination.

Note

This product is intended for research use only.

Summary

Research topic

Diabetology - Other Relevant Products, Neural tissue markers, Pulmonary diseases, Renal disease

Summary

The receptor for advanced glycation end products (RAGE) is a multiligand member of the immunoglobulin superfamily of cell surface molecules. It mediates interactions of advanced glycation end products (AGE), the products of nonenzymatic glycoxidation of proteins/lipids that accumulate in the plasma and tissues of patients with diabetes.

Product References (4)

References

  • Zenker HE, Teodorowicz M, Wichers HJ, Hettinga KA. No Glycation Required: Interference of Casein in AGE Receptor Binding Tests. Foods. 2021 Aug 9;10(8):1836. doi: 10.3390/foods10081836. PubMed PMID: 34441613. PubMed CentralPMCID: PMC8394258. See more on PubMed
  • Zenker HE, Teodorowicz M, Ewaz A, van Neerven RJJ, Savelkoul HFJ, De Jong NW, Wichers HJ, Hettinga KA. Binding of CML-Modified as Well as Heat-Glycated β-lactoglobulin to Receptors for AGEs Is Determined by Charge and Hydrophobicity. Int J Mol Sci. 2020 Jun 26;21(12):4567. doi: 10.3390/ijms21124567. PubMed PMID: 32604964. PubMed CentralPMCID: PMC7348724. See more on PubMed
  • Zenker HE, Ewaz A, Deng Y, Savelkoul HFJ, van Neerven RJJ, De Jong NW, Wichers HJ, Hettinga KA, Teodorowicz M. Differential Effects of Dry vs. Wet Heating of β-Lactoglobulin on Formation of sRAGE Binding Ligands and sIgE Epitope Recognition. Nutrients. 2019 Jun 25;11(6):1432. doi: 10.3390/nu11061432. PubMed PMID: 31242665. PubMed CentralPMCID: PMC6627217. See more on PubMed
  • Liu F, Teodorowicz M, Wichers HJ, van Boekel MA, Hettinga KA. Generation of Soluble Advanced Glycation End Products Receptor (sRAGE)-Binding Ligands during Extensive Heat Treatment of Whey Protein/Lactose Mixtures Is Dependent on Glycation and Aggregation. J Agric Food Chem. 2016 Aug 24;64(33):6477-86. doi: 10.1021/acs.jafc.6b02674. Epub 2016 Aug 15. PubMed PMID: 27460534. See more on PubMed
Summary References (12)

References to Soluble Receptor for Advanced Glycation End Products (sRAGE)

  • Brett J, Schmidt AM, Yan SD, Zou YS, Weidman E, Pinsky D, Nowygrod R, Neeper M, Przysiecki C, Shaw A, et al. Survey of the distribution of a newly characterized receptor for advanced glycation end products in tissues. Am J Pathol. 1993 Dec;143 (6):1699-712
  • Emanuele E, D'Angelo A, Tomaino C, Binetti G, Ghidoni R, Politi P, Bernardi L, Maletta R, Bruni AC, Geroldi D. Circulating levels of soluble receptor for advanced glycation end products in Alzheimer disease and vascular dementia. Arch Neurol. 2005 Nov;62 (11):1734-6
  • Falcone C, Emanuele E, D'Angelo A, Buzzi MP, Belvito C, Cuccia M, Geroldi D. Plasma levels of soluble receptor for advanced glycation end products and coronary artery disease in nondiabetic men. Arterioscler Thromb Vasc Biol. 2005 May;25 (5):1032-7
  • Geroldi D, Falcone C, Emanuele E. Soluble receptor for advanced glycation end products: from disease marker to potential therapeutic target. Curr Med Chem. 2006;13 (17):1971-8
  • Ghidoni R, Benussi L, Glionna M, Franzoni M, Geroldi D, Emanuele E, Binetti G. Decreased plasma levels of soluble receptor for advanced glycation end products in mild cognitive impairment. J Neural Transm. 2008 Jul;115 (7):1047-50
  • Goh SY, Cooper ME. Clinical review: The role of advanced glycation end products in progression and complications of diabetes. J Clin Endocrinol Metab. 2008 Apr;93 (4):1143-52
  • Goldin A, Beckman JA, Schmidt AM, Creager MA. Advanced glycation end products: sparking the development of diabetic vascular injury. Circulation. 2006 Aug 8;114 (6):597-605
  • Gugliucci A. Glycation as the glucose link to diabetic complications. J Am Osteopath Assoc. 2000 Oct;100 (10):621-34
  • Hudson BI, Harja E, Moser B, Schmidt AM. Soluble levels of receptor for advanced glycation endproducts (sRAGE) and coronary artery disease: the next C-reactive protein?. Arterioscler Thromb Vasc Biol. 2005 May;25 (5):879-82
  • Kalousova M, Hodkova M, Kazderova M, Fialova J, Tesar V, Dusilova-Sulkova S, Zima T. Soluble receptor for advanced glycation end products in patients with decreased renal function. Am J Kidney Dis. 2006 Mar;47 (3):406-11
  • Pullerits R, Bokarewa M, Dahlberg L, Tarkowski A. Decreased levels of soluble receptor for advanced glycation end products in patients with rheumatoid arthritis indicating deficient inflammatory control. Arthritis Res Ther. 2005;7 (4):R817-24
  • Schmidt AM, Vianna M, Gerlach M, Brett J, Ryan J, Kao J, Esposito C, Hegarty H, Hurley W, Clauss M, et al. Isolation and characterization of two binding proteins for advanced glycosylation end products from bovine lung which are present on the endothelial cell surface. J Biol Chem. 1992 Jul 25;267 (21):14987-97
Related Products Docs