Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Hepatitis B Protein X (HBx) Virus Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:HBx
Please select your region to see available products and prices.
Cat. No. Size Price


RD981038100 0.05 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, Immunoprecipitation

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant HBx.

Amino Acid Sequence

The immunization antigen (17 kDa) is a protein containing 153 AA of recombinant HBx and one extra AA, N-terminal methionin (highlighted).

MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNFFTSA

Species Reactivity

Human

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Hepatitis B Protein X.

Antibody Content

0.05 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.05 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Others

Summary

Hepatitis B virus X protein (HBx) is a 17 kD transcriptional coactivator that plays a significant role in the regulation of genes involved in inflammation and cell survival. It regulates many transcription factors including nuclear factor kappa B (NF-kappaB) and plays a key role in hepatocarcino­genesis. HBx facilitates the binding of cAMP response element binding protein (CREB) to its responsive element. HBx stabilizes the cellular coactivator ASC-2 through direct protein-protein interaction, affecting the regulation of genes actively transcribed in liver cancer cells. HBx transactivates both JNK and MAPK signal transduction pathways in association with the mobilization of cytosolic Ca2+. The communication between HBx and general transcription factor TFIIB is also one of the mechanisms which account for its transcriptional transactivation. HBx decreased the expression of PTEN a known tumor suppressor and a negative regulator of phosphatidyli­nositol 3'-kinase/AKT and HBx decreased the expression of PTEN in HBx-transfected cells. The etiology of hepatocellular carcinoma (HCC) is involved with hepatitis B virus (HBV) infection and HBx in particular plays a role in the development of HBV-related HCC. The persistence of HBx is important to the pathogenesis of early HCC and HBx expression in the liver during chronic HBV infection may be an important prognostic marker for the development of HCC.

References to Product

References

  • Kim W, Lee S, Son Y, Ko C, Ryu WS. DDB1 stimulates the viral transcription of hepatitis B virus via HBx-independent mechanisms. J Virol. 2016 Aug 17;
  • Lee AR, Lim KH, Park ES, et al. Multiple Functions of Cellular FLIP Are Essential for Replication of Hepatitis B Virus. J Virol. 2018;92(16):e00339-18. Published 2018 Jul 31. doi:10.1128/JVI.00339-18
References to Summary

References to Hepatitis B Virus Protein X

  • Arbuthnot P, Kew M. Hepatitis B virus and hepatocellular carcinoma. Int J Exp Pathol. 2001 Apr; 82(2): 77-100. Review.
  • Hwang GY, Lin CY, Huang LM, Wang YH, Wang JC, Hsu CT, Yang SS, Wu CC. Detection of the hepatitis B virus X protein (HBx) antigen and anti-HBx antibodies in cases of human hepatocellular carcinoma. J Clin Microbiol. 2003 Dec; 41(12): 5598-603.
  • Madden CR, Slagle BL. Stimulation of cellular proliferation by hepatitis B virus X protein. Dis Markers. 2001; 17(3): 153-7. Review.
  • Song CZ, Bai ZL, Song CC, Wang QW. Aggregate formation of hepatitis B virus X protein affects cell cycle and apoptosis. World J Gastroenterol. 2003 Jul; 9(7): 1521-4.
  • Tralhao JG, Roudier J, Morosan S, Giannini C, Tu H, Goulenok C, Carnot F, Zavala F, Joulin V, Kremsdorf D, Brechot C. Paracrine in vivo inhibitory effects of hepatitis B virus X protein (HBx) on liver cell proliferation: an alternative mechanism of HBx-related pathogenesis. Proc Natl Acad Sci U S A. 2002 May 14; 99(10): 6991-6.
Related Products Documents