Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

S100A12 Human, Sheep Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:S100 calcium-binding protein A12, Calgranulin-C, CAGC, Neutrophil S100 protein, Calcium-binding protein in amniotic fluid 1, CAAF1, p6, Extracellular newly identified, RAGE-binding protein, EN-RAGE
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD184221100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Sheep

Preparation

The antibody was raised in sheep by immunization with the recombinant Human S100A12.

Amino Acid Sequence

Total 101 AA. MW: 11.63 kDa (calculated). UniProtKB acc.no. P80511. N-Terminal His-tag, 10 extra AA (highlighted).

MKHHHHHHASTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human S100A12.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Note

This product is for research use only.

Summary

Research topic

Immune Response, Infection and Inflammation, Inflammatory bowel disease, Lipoprotein metabolism, Neural tissue markers, Oncology, Pulmonary diseases, Renal disease

Summary

S100A12 (EN-RAGE, calgranulin) is a member of the S100 protein family, which, in humans, consists of twenty five EF-hand (alpha helix-loop-alpha helix), calcium-binding proteins, of which the vast majority is in homodimer, heterodimer or more complex forms. Mature S100A12 consists of 91 amino acids (Mw 10.4 kDa); it is predominantly expressed and secreted by neutrophil granulocytes and to a lower extent, it was found in monocytes. Hofmann et al. (1999) reported that RAGE is a central cell surface receptor for S100A12, which they referred to as EN-RAGE (Extracellular Newly identified RAGE-binding protein), and related members of the S100/calgranulin superfamily. Interaction of EN-RAGE (S100A12) with cellular RAGE on endothelium, mononuclear phagocytes, and lymphocytes triggered cellular activation, with generation of key proinflammatory mediators. In murine models, blockade of EN-RAGE/RAGE quenched delayed-type hypersensitivity and inflammatory colitis by arresting activation of central signaling pathways and expression of inflammatory gene mediators. With regard to its inflammatory properties, S100A12 was already described as a promising marker for many diseases in humans such as neurodegenerative diseases, atherosclerosis, cancerogenesis, osteoarthritis, familial mediterranean fever and idiopathic pulmonary fibrosis. Plasma S100A12 level is associated with cardiovascular disease in hemodialysis patients. S100A12 and its receptor RAGE are found at high concentrations in pulmonary tissue and bronchoalveolar lavage fluid in acute lung injury. S100A12 expression reflects neutrophil activation during lung inflammation. Faecal S100A12 is a novel non-invasive marker distinguishing inflammatory bowel disease (IBD) from irritable bowel syndrome (IBS). Furthermore, S100A12 reflects inflammatory activity of chronic IBD. As a marker of neutrophil activation, faecal S100A12 may significantly improve the arsenal of non-invasive biomarkers of intestinal inflammation.

Summary References (15)

References to S100A12

  • Goyette J, Yan WX, Yamen E, Chung YM, Lim SY, Hsu K, Rahimi F, Di Girolamo N, Song C, Jessup W, Kockx M, Bobryshev YV, Freedman SB, Geczy CL. Pleiotropic roles of S100A12 in coronary atherosclerotic plaque formation and rupture. J Immunol. 2009 Jul 1;183 (1):593-603
  • Hofmann Bowman M, Wilk J, Heydemann A, Kim G, Rehman J, Lodato JA, Raman J, McNally EM. S100A12 mediates aortic wall remodeling and aortic aneurysm. Circ Res. 2010 Jan 8;106 (1):145-54
  • Kallinich T, Wittkowski H, Keitzer R, Roth J, Foell D. Neutrophil-derived S100A12 as novel biomarker of inflammation in familial Mediterranean fever. Ann Rheum Dis. 2010 Apr;69 (4):677-82
  • Kalousova M, Kubena AA, Benakova H, Dusilova-Sulkova S, Tesar V, Zima T. EN-RAGE (extracellular newly identified receptor for advanced glycation end-products binding protein) and mortality of long-term hemodialysis patients: A prospective observational cohort study. Clin Biochem. 2012 May;45 (7-8):556-60
  • Kikkawa T, Sato N, Kojika M, Takahashi G, Aoki K, Hoshikawa K, Akitomi S, Shozushima T, Suzuki K, Wakabayashi G, Endo S. Significance of measuring S100A12 and sRAGE in the serum of sepsis patients with postoperative acute lung injury. Dig Surg. 2010;27 (4):307-12
  • Kosaki A, Hasegawa T, Kimura T, Iida K, Hitomi J, Matsubara H, Mori Y, Okigaki M, Toyoda N, Masaki H, Inoue-Shibata M, Nishikawa M, Iwasaka T. Increased plasma S100A12 (EN-RAGE) levels in patients with type 2 diabetes. J Clin Endocrinol Metab. 2004 Nov;89 (11):5423-8
  • Mahajan N, Malik N, Bahl A, Dhawan V. Receptor for advanced glycation end products (RAGE) and its inflammatory ligand EN-RAGE in non-diabetic subjects with pre-mature coronary artery disease. Atherosclerosis. 2009 Dec;207 (2):597-602
  • Miniati M, Monti S, Basta G, Cocci F, Fornai E, Bottai M. Soluble receptor for advanced glycation end products in COPD: relationship with emphysema and chronic cor pulmonale: a case-control study. Respir Res. 2011;12:37
  • Mori Y, Kosaki A, Kishimoto N, Kimura T, Iida K, Fukui M, Nakajima F, Nagahara M, Urakami M, Iwasaka T, Matsubara H. Increased plasma S100A12 (EN-RAGE) levels in hemodialysis patients with atherosclerosis. Am J Nephrol. 2009;29 (1):18-24
  • Myles A, Viswanath V, Singh YP, Aggarwal A. Soluble receptor for advanced glycation endproducts is decreased in patients with juvenile idiopathic arthritis (ERA category) and inversely correlates with disease activity and S100A12 levels. J Rheumatol. 2011 Sep;38 (9):1994-9
  • Nakashima M, Sakai T, Hiraiwa H, Hamada T, Omachi T, Ono Y, Inukai N, Ishizuka S, Matsukawa T, Oda T, Takamatsu A, Yamashita S, Ishiguro N. Role of S100A12 in the pathogenesis of osteoarthritis. Biochem Biophys Res Commun. 2012 Jun 8;422 (3):508-14
  • Shiotsu Y, Mori Y, Nishimura M, Sakoda C, Tokoro T, Hatta T, Maki N, Iida K, Iwamoto N, Ono T, Matsuoka E, Kishimoto N, Tamagaki K, Matsubara H, Kosaki A. Plasma S100A12 level is associated with cardiovascular disease in hemodialysis patients. Clin J Am Soc Nephrol. 2011 Apr;6 (4):718-23
  • Shiotsu Y, Mori Y, Nishimura M, Sakoda C, Tokoro T, Hatta T, Maki N, Iida K, Iwamoto N, Ono T, Matsuoka E, Kishimoto N, Tamagaki K, Matsubara H, Kosaki A. Plasma S100A12 level is associated with cardiovascular disease in hemodialysis patients. Clin J Am Soc Nephrol. 2011 Apr;6 (4):718-23
  • Thierolf M, Hagmann ML, Pfeffer M, Berntenis N, Wild N, Roessler M, Palme S, Karl J, Bodenmuller H, Ruschoff J, Rossol S, Rohr G, Rosch W, Friess H, Eickhoff A, Jauch KW, Langen H, Zolg W, Tacke M. Towards a comprehensive proteome of normal and malignant human colon tissue by 2-D-LC-ESI-MS and 2-DE proteomics and identification of S100A12 as potential cancer biomarker. Proteomics Clin Appl. 2008 Jan;2 (1):11-22
  • Wittkowski H, Frosch M, Wulffraat N, Goldbach-Mansky R, Kallinich T, Kuemmerle-Deschner J, Fruhwald MC, Dassmann S, Pham TH, Roth J, Foell D. S100A12 is a novel molecular marker differentiating systemic-onset juvenile idiopathic arthritis from other causes of fever of u
Related Products Docs