Select country change
Shopping cart (0 , 0,00 ) Menu Search
Manufactured by BioVendor

Secretagogin Human, Rabbit Polyclonal Antibody

  • Regulatory status:RUO
  • Type:Polyclonal Antibody
  • Other names:SCGN, SECRET
  • Species:Human
Please select your region to see available products and prices.
Cat. No. Size Price


RD181120100 0.1 mg
PubMed Product Details
Technical Data

Type

Polyclonal Antibody

Applications

Western blotting, ELISA, Immunohistochemistry

Antibodies Applications

Source of Antigen

E. coli

Hosts

Rabbit

Preparation

The antibody was raised in rabbits by immunization with the recombinant Human Secretagogin.

Amino Acid Sequence

The immunization antigen (33.3 kDa) is a protein containing 276 AA of recombinant Human Secretagogin and 10 extra AA, N-terminal His-tag (highlighted). The AA sequence is identical to UniProtKB/Swiss-Prot entry O76038.

MKHHHHHHASMDSSREPTLGRLDAAGFWQVWRRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Species Reactivity

Human. Not yet tested in other species.

Purification Method

Immunoaffinity chromatography on a column with immobilized recombinant Human Secretagogin.

Antibody Content

0.1 mg (determined by BCA method, BSA was used as a standard)

Formulation

The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. AZIDE FREE.

Reconstitution

Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.

Shipping

At ambient temperature. Upon receipt, store the product at the temperature recommended below.

Storage/Expiration

The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.

Quality Control Test

Indirect ELISA – to determine titer of the antibody SDS PAGE – to determine purity of the antibody

Summary

Research topic

Diabetology - Other Relevant Products, Neural tissue markers, Oncology

Product References (6)

References

  • Puthussery T, Gayet-Primo J, Taylor WR, Haverkamp S. Immunohistochemicalidentification and synaptic inputs to the diffuse bipolar cell type DB1 inmacaque retina. J Comp Neurol. 2011 Dec 15;519(18):3640-56. doi:10.1002/cne.22756. PubMed PMID: 22006647; PubMed Central PMCID: PMC3500389. See more on PubMed
  • Kerov V, Laird JG, Joiner ML, Knecht S, Soh D, Hagen J, Gardner SH, Gutierrez W, Yoshimatsu T, Bhattarai S, Puthussery T, Artemyev NO, Drack AV, Wong RO, BakerSA, Lee A. α(2)δ-4 Is Required for the Molecular and Structural Organization ofRod and Cone Photoreceptor Synapses. J Neurosci. 2018 Jul 4;38(27):6145-6160.doi: 10.1523/JNEUROSCI.3818-16.2018. Epub 2018 Jun 6. PubMed PMID: 29875267;PubMed Central PMCID: PMC6031576. See more on PubMed
  • Park KU, Randazzo G, Jones KL, Brzezinski JA 4th. Gsg1, Trnp1, and Tmem215Mark Subpopulations of Bipolar Interneurons in the Mouse Retina. InvestOphthalmol Vis Sci. 2017 Feb 1;58(2):1137-1150. doi: 10.1167/iovs.16-19767.PubMed PMID: 28199486; PubMed Central PMCID: PMC5317276. See more on PubMed
  • Clements R, Turk R, Campbell KP, Wright KM. Dystroglycan Maintains InnerLimiting Membrane Integrity to Coordinate Retinal Development. J Neurosci. 2017Aug 30;37(35):8559-8574. doi: 10.1523/JNEUROSCI.0946-17.2017. Epub 2017 Jul 31.PubMed PMID: 28760865; PubMed Central PMCID: PMC5577860. See more on PubMed
  • Peng YR, Tran NM, Krishnaswamy A, Kostadinov D, Martersteck EM, Sanes JR.Satb1 Regulates Contactin 5 to Pattern Dendrites of a Mammalian Retinal Ganglion Cell. Neuron. 2017 Aug 16;95(4):869-883.e6. doi: 10.1016/j.neuron.2017.07.019.Epub 2017 Aug 3. PubMed PMID: 28781169; PubMed Central PMCID: PMC5575751. See more on PubMed
  • Grassmeyer JJ, Cahill AL, Hays CL, Barta C, Quadros RM, Gurumurthy CB,Thoreson WB. Ca(2+) sensor synaptotagmin-1 mediates exocytosis in mammalianphotoreceptors. Elife. 2019 Jun 7;8. pii: e45946. doi: 10.7554/eLife.45946.PubMed PMID: 31172949; PubMed Central PMCID: PMC6588344. See more on PubMed
Summary References (8)

References to Secretagogin

  • Adolf K, Wagner L, Bergh A, Stattin P, Ottosen P, Borre M, Birkenkamp-Demtroder K, Orntoft TF, Torring N. Secretagogin is a new neuroendocrine marker in the human prostate. Prostate. 2007 Apr 1;67 (5):472-84
  • Gartner W, Lang W, Leutmetzer F, Domanovits H, Waldhausl W, Wagner L. Cerebral expression and serum detectability of secretagogin, a recently cloned EF-hand Ca(2+)-binding protein. Cereb Cortex. 2001 Dec;11 (12):1161-9
  • Gartner W, Vila G, Daneva T, Nabokikh A, Koc-Saral F, Ilhan A, Majdic O, Luger A, Wagner L. New functional aspects of the neuroendocrine marker secretagogin based on the characterization of its rat homolog. Am J Physiol Endocrinol Metab. 2007 Jul;293 (1):E347-54
  • Gartner W, Zierhut B, Mineva I, Sodeck G, Leutmezer F, Domanovits H, Prayer D, Wolf F, Base W, Weissel M, Wagner L. Brain natriuretic peptide correlates with the extent of atrial fibrillation-associated silent brain lesions. Clin Biochem. 2008 Dec;41 (18):1434-9
  • Lai M, Lu B, Xing X, Xu E, Ren G, Huang Q. Secretagogin, a novel neuroendocrine marker, has a distinct expression pattern from chromogranin A. Virchows Arch. 2006 Oct;449 (4):402-9
  • Pipp I, Wagner L, Rossler K, Budka H, Preusser M. Secretagogin expression in tumours of the human brain and its coverings. APMIS. 2007 Apr;115 (4):319-26
  • Rogstam A, Linse S, Lindqvist A, James P, Wagner L, Berggard T. Binding of calcium ions and SNAP-25 to the hexa EF-hand protein secretagogin. Biochem J. 2007 Jan 1;401 (1):353-63
  • Wagner L, Oliyarnyk O, Gartner W, Nowotny P, Groeger M, Kaserer K, Waldhausl W, Pasternack MS. Cloning and expression of secretagogin, a novel neuroendocrine- and pancreatic islet of Langerhans-specific Ca2+-binding protein. J Biol Chem. 2000 Aug 11;275 (32):24740-51
Related Products Docs